PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA12G0066300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 999aa    MW: 109488 Da    PI: 4.9153
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA12G0066300.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.81.2e-1855101148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        +g+WT+eEd +l +av+ + g++Wk+Ia++++  Rt+ qc +rwqk+l
  ORGLA12G0066300.1  55 KGNWTPEEDAILSRAVQTYKGKNWKKIAECFP-DRTDVQCLHRWQKVL 101
                        79******************************.************986 PP

2Myb_DNA-binding59.95.5e-19107153148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        +g+W++eEd+++v+ v++lG++ W+tIa+ ++ gR +kqc++rw+++l
  ORGLA12G0066300.1 107 KGPWSKEEDDIIVQMVNKLGPKKWSTIAQALP-GRIGKQCRERWHNHL 153
                        79******************************.*************97 PP

3Myb_DNA-binding47.25.2e-15159201145
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        + +WT+eE+  l++a++++G++ W+   + ++ gRt++ +k++w+
  ORGLA12G0066300.1 159 KEAWTQEEEITLIHAHRMYGNK-WAELTKFLP-GRTDNAIKNHWN 201
                        579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.56650101IPR017930Myb domain
SuperFamilySSF466891.51E-1953116IPR009057Homeodomain-like
SMARTSM007173.5E-1754103IPR001005SANT/Myb domain
PfamPF002491.6E-1655101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-2457118IPR009057Homeodomain-like
CDDcd001679.46E-1557101No hitNo description
PROSITE profilePS5129431.404102157IPR017930Myb domain
SuperFamilySSF466891.55E-30104200IPR009057Homeodomain-like
SMARTSM007172.2E-17106155IPR001005SANT/Myb domain
PfamPF002493.3E-17107153IPR001005SANT/Myb domain
CDDcd001675.16E-15109153No hitNo description
Gene3DG3DSA:1.10.10.606.6E-26119160IPR009057Homeodomain-like
SMARTSM007174.4E-14158206IPR001005SANT/Myb domain
PROSITE profilePS5129419.654158208IPR017930Myb domain
PfamPF002491.9E-13159202IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-21161208IPR009057Homeodomain-like
CDDcd001677.15E-11161201No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 999 aa     Download sequence    Send to blast
MSSVMMTSDN GKAPEKGGEA SGPSSAPQEG EISNEPQRRR PLSGRTTGPT RRSTKGNWTP  60
EEDAILSRAV QTYKGKNWKK IAECFPDRTD VQCLHRWQKV LNPELVKGPW SKEEDDIIVQ  120
MVNKLGPKKW STIAQALPGR IGKQCRERWH NHLNPGINKE AWTQEEEITL IHAHRMYGNK  180
WAELTKFLPG RTDNAIKNHW NSSVKKKVDS YMSSGLLTQV SCLPLNEYSA HCNSSPALTQ  240
QNSEDSGSYA VREVENSSVC SQSSLAKVSC SQVHNANVAL GCDLQVNANV DNNEAHDSQS  300
SVGHEACYTS VGAVATAIPE VHYHVSSSNF DPDQHLQEEF AQGLNLHMSM DEVPSNSSFA  360
DNPTICSIEN HERSLEPYDV AMEMPLSMLP SDSGAEQKLH FMSEADFNSP NCLKSELWQD  420
ISLQSLLSGP DAVETDSFSR SNHQSDVYSS QADNEFLAPP YLLQTSNSSS VMEATYGQSP  480
QMSVPPSLIC SNVMTDVPSD NRSEPKEMTV SQAEMVTQSS SSSGDAEMSA NPGSSNGSDI  540
PSMMERIPEC ADQHVTNAEE PEASIEKEPS VTLSATADEK QDEGALFYEP PRFPSMDVPF  600
VSCDLVTSGD LQEYSPLGIR QLMRSTMNVC TPMRLWGSPT HDESPDILLK SAAKSFICTP  660
SILKKRHRDL VSPIPDKRIE KKSGTEKDCG VSDTSSIGIQ TCFINATKDD AVITKSILRI  720
ERSASSKPLE KKLEFSDENK ENLDNTIEQA KDGQSAGNYK HIDEQARGER RTATNITTTY  780
DDLPGNLQPA GILIEHNGDD LVSPDYGKNT MKQKQNTNME SLSVCKEGVS AKKPAELIVE  840
KSSAYINVDY EYVNILADTP GIKRGLESPS AWKSPWFVDM QFQGSYFVSP ANGSYDALGL  900
VKQINVQTAA ALAEAREVLA SGGQSENINS DKENLENPDA KKEPGATTKL QAKIKTEGKI  960
LDFNECATPI RSSDKKAGSS LGRSLSSPIP SSHLLKSFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C5e-66552086159MYB PROTO-ONCOGENE PROTEIN
1h89_C5e-66552086159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4300510.0AJ430051.1 Oryza sativa mRNA for transcription factor myb (myb3R1 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006663924.20.0PREDICTED: myb-related protein 3R-1-like isoform X2
TrEMBLI1R5570.0I1R557_ORYGL; Uncharacterized protein
STRINGORGLA12G0066300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.11e-94Homeodomain-like protein